SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445569 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445569
Domain Number 1 Region: 1022-1148,1343-1494
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.71e-40
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 2 Region: 16-124
Classification Level Classification E-value
Superfamily Sema domain 3.14e-20
Family Sema domain 0.011
Further Details:      
 
Domain Number 3 Region: 577-666
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000205
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 485-580
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000539
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 127-179
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000929
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 665-709,747-800
Classification Level Classification E-value
Superfamily E set domains 0.000000163
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.06
Further Details:      
 
Domain Number 7 Region: 814-895
Classification Level Classification E-value
Superfamily E set domains 0.0000358
Family E-set domains of sugar-utilizing enzymes 0.042
Further Details:      
 
Weak hits

Sequence:  ENSP00000445569
Domain Number - Region: 282-313
Classification Level Classification E-value
Superfamily Plexin repeat 0.0275
Family Plexin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445569   Gene: ENSG00000198753   Transcript: ENST00000538776
Sequence length 1562
Comment pep:known chromosome:GRCh37:X:153029726:153044795:1 gene:ENSG00000198753 transcript:ENST00000538776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHAAQETPLLHHFMDSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADG
HMIAFLGDTQGQLYKVFLHGSQGQVYHSQQVGPPGSAISPDLLLDSSGSHLYVLTAHQVD
RIPVAACPQFPDCASCLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLWSYEEDSHCLH
IQSLLPGHHPRQEQGQVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQ
VPLNPPGTDHVTVPLALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCP
QSSHCVYGEHCPEGERTIYSAQEVDIQVRGPGACPQVEGLAGPHLVPVGWESHLALRVRN
LQHFRGLPASFHCWLELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYV
TQGEAQRLDNTHALYVILYDCAMGHPDCSHCQAANRSLGCLWCADGQPACRYGPLCPPGA
VELLCPAPSIDAVEPLTGPPEGGLALTILGSNLGRAFADVQYAVSVASRPCNPEPSLYRT
SARIVCVTSPAPNGTTGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTI
RGQHLQTGGNTSAFVGGQPCPILEPVCPEAIVCRTRPQAAPGEAAVLVVFGHAQRTLLAS
PFRYTANPQLVAAEPSASFRGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQD
PQPRRSCGAPAADPQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLD
NVQVDFASASGGQGFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVR
VHIGRGECLVKTLTRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALGPVQYEAEPPL
SAFPVEAQAGVGMGAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLESLETGVGDQCRK
EFTDLMTEMTDLSSDLEGSGIPFLDYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVR
QGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRTLL
GDLAAHYVHRNPKLMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVDK
GPVDAVTGKAKRTLNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSEMQRVPARVLDTDT
ITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTL
QHYKVPDGATVGLVPQLHRGSTISQSLAQRCPLGENIPTLEDGEEGGVCLWHLVKATEEP
EGAKVRCSSLREREPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAVKY
LFDLLDELAEKHGIEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIA
QTFIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAE
LSGNYTSAPHCLEALQELYNHIHRYYDQIISALEEDPVGQKLQLACRLQQVAALVENKVT
DL
Download sequence
Identical sequences B7Z3H9
ENSP00000445569 ENSP00000469584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]