SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000445836 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000445836
Domain Number 1 Region: 285-385
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.21e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 20-90
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000327
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 106-160,188-202
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000067
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000445836   Gene: ENSG00000029153   Transcript: ENST00000542388
Sequence length 551
Comment pep:known chromosome:GRCh37:12:27521269:27573523:1 gene:ENSG00000029153 transcript:ENST00000542388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFSSHMTEFPRKRKGSDSDPSQEAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLD
KLTVLRMAVQHLRSLKGLTNSYVGSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKIL
FVSKSVSKILNYDQASLTGQSLFDFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHS
NLHAGRTRVYSGSRRSFFCRIKSCKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPP
NIVGMEEERNSKKDNSNFTCLVAIGRLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVD
QRATAILGYLPQELLGTSCYEYFHQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFV
TLKSQWFSFTNPWTKELEYIVSVNTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGM
STGTVLGAGSIGTDIANEILDLQRLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKELFPPS
PSEMGELEATRQNQSTVAVHSHEPLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGD
PGDFSDIQWTL
Download sequence
Identical sequences ENSP00000445836 ENSP00000445836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]