SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000447393 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000447393
Domain Number - Region: 27-104
Classification Level Classification E-value
Superfamily Tropomyosin 0.00647
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447393   Gene: ENSG00000161800   Transcript: ENST00000552921
Sequence length 150
Comment pep:known chromosome:GRCh37:12:50398061:50419340:-1 gene:ENSG00000161800 transcript:ENST00000552921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTMMLNVRNLFEQLVRRVEILSEGNEVQFIQLAKDFEDFRKKWQRTDHELGKYKDLLMK
AETERSALDVKLKHARNQVDVEIKRRQRAEADCEKLERQIQLIREMLMCDTSGSIQLSEE
QKSALAFLNRGQPSSSNAGNKRLSTIDESG
Download sequence
Identical sequences F8VZ66
ENSP00000447393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]