SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447433 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447433
Domain Number 1 Region: 199-323
Classification Level Classification E-value
Superfamily CBS-domain pair 1.95e-52
Family CBS-domain pair 0.00000144
Further Details:      
 
Domain Number 2 Region: 43-176
Classification Level Classification E-value
Superfamily CBS-domain pair 1.85e-51
Family CBS-domain pair 0.00000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447433   Gene: ENSG00000181929   Transcript: ENST00000548065
Sequence length 331
Comment pep:known chromosome:GRCh37:12:49396064:49412980:-1 gene:ENSG00000181929 transcript:ENST00000548065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKKP
Download sequence
Identical sequences A0A024R125 P54619
gi|4506061|ref|NP_002724.1| ENSP00000447433 ENSP00000447433 4cfe_E 4cfe_F 4cff_E 4cff_F 5iso_E 5iso_F 9606.ENSP00000323867 NP_002724.1.87134 NP_002724.1.92137 400292 GO.35427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]