SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447637 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000447637
Domain Number - Region: 25-55
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0953
Family CBS-domain pair 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447637   Gene: ENSG00000181929   Transcript: ENST00000546531
Sequence length 82
Comment pep:known chromosome:GRCh37:12:49396095:49412570:-1 gene:ENSG00000181929 transcript:ENST00000546531 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQSCPC
GFAFMIITVLATGEESFFCFGD
Download sequence
Identical sequences F8W046
ENSP00000447637 ENSP00000447637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]