SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000447671 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000447671
Domain Number 1 Region: 5-85
Classification Level Classification E-value
Superfamily CBS-domain pair 7.27e-17
Family CBS-domain pair 0.00000555
Further Details:      
 
Domain Number 2 Region: 142-200
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000193
Family CBS-domain pair 0.0000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000447671   Gene: ENSG00000181929   Transcript: ENST00000551696
Sequence length 202
Comment pep:putative chromosome:GRCh37:12:49396752:49412560:-1 gene:ENSG00000181929 transcript:ENST00000551696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSILKVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEE
HKIETWREVYLQDSFKPLVCISPNARSLSSPSQSSCPSLWKSYRLAPMPILLWFALPPPS
MWLWGFLYSIESQPCQWWMRRNLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLE
TIINRLVEAEVHRLVVVDENDV
Download sequence
Identical sequences F8VZX1
ENSP00000447671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]