SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000448251 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448251
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily CBS-domain pair 2.78e-35
Family CBS-domain pair 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448251   Gene: ENSG00000181929   Transcript: ENST00000552463
Sequence length 125
Comment pep:putative chromosome:GRCh37:12:49398355:49412198:-1 gene:ENSG00000181929 transcript:ENST00000552463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFI
NILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHR
LPVID
Download sequence
Identical sequences A0A2J8LQ32 A0A2J8SYT2 F8VSL2
ENSP00000448251 ENSP00000448251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]