SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000448480 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448480
Domain Number 1 Region: 306-489,553-754,784-814
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-91
Family Ras GEF 0.0011
Further Details:      
 
Domain Number 2 Region: 55-185
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.57e-28
Family DEP domain 0.0000456
Further Details:      
 
Domain Number 3 Region: 179-308
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.68e-26
Family cAMP-binding domain 0.0000033
Further Details:      
 
Domain Number 4 Region: 518-562
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000661
Family Ras-binding domain, RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448480   Gene: ENSG00000079337   Transcript: ENST00000548919
Sequence length 814
Comment pep:novel chromosome:GRCh37:12:48131323:48164823:-1 gene:ENSG00000079337 transcript:ENST00000548919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRRMHRPRSCSYQLLLEHQRPSCIQGLRWTPLTNSEESLDFSESLEQASTERVLRAGR
QLHRHLLATCPNLIRDRKYHLRLYRQCCSGRELVDGILALGLGVHSRSQVVGICQVLLDE
GALCHVKHDWAFQDRDAQFYRFPGPEPEPVRTHEMEEELAEAVALLSQRGPDALLTVALR
KPPGQRTDEELDLIFEELLHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTS
WYIIWKGSVNVVTHGKGLVTTLHEGDDFGQLALVNDAPRAATIILREDNCHFLRVDKQDF
NRIIKDVEAKTMRLEEHGKVVLVLERASQGAGPSRPPTPGRNRYTVMSGTPEKILELLLE
AMGPDSSAHDPTETFLSDFLLTHRVFMPSAQLCAALLHHFHVEPAGGSEQERSTYVCNKR
QQILRLVSQWVALYGSMLHTDPVATSFLQKLSDLVGRDTRLSNLLREQWPERRRCHRLEN
GCGNASPQMKARNLPVWLPNQDEPLPGSSCAIQVGDKDAIGLQPDARGVATSLGLNERLF
VVNPQEVHELIPHPDQLGPTVGSAEGLDLVSAKDLAGQLTDHDWSLFNSIHQVELIHYVL
GPQHLRDVTTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHNSAISRL
AHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALAKLSPPVIPFMPLLLKDMTFIHEGN
HTLVENLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVARISTCSEQS
LSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
Download sequence
Identical sequences F8VRX1
ENSP00000448480 ENSP00000448480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]