SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000448739 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448739
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily CBS-domain pair 2.49e-21
Family CBS-domain pair 0.00000616
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448739   Gene: ENSG00000181929   Transcript: ENST00000548857
Sequence length 82
Comment pep:putative chromosome:GRCh37:12:49398914:49412558:-1 gene:ENSG00000181929 transcript:ENST00000548857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFI
NILHRYYKSALVQIYELEEHKI
Download sequence
Identical sequences A0A2J8LQ60 A0A2J8SYR2 F8VRY2
ENSP00000448739 ENSP00000448739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]