SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000448972 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000448972
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily CBS-domain pair 3.16e-41
Family CBS-domain pair 0.0000000682
Further Details:      
 
Domain Number 2 Region: 156-292
Classification Level Classification E-value
Superfamily CBS-domain pair 3.76e-33
Family CBS-domain pair 0.0000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000448972   Gene: ENSG00000181929   Transcript: ENST00000552212
Sequence length 299
Comment pep:putative chromosome:GRCh37:12:49396397:49412531:-1 gene:ENSG00000181929 transcript:ENST00000552212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFI
NILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHR
LPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTP
VYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHY
FEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
Download sequence
Identical sequences A0A2J8SYU0 A0A2K5K7V5 A0A2K5ZZ03 Q4R5P4
ENSP00000448972 ENSP00000448972 NP_001193639.1.87134 NP_001193639.1.92137 NP_001270454.1.63531 XP_005570797.1.63531 XP_006719562.1.92137 XP_008568892.1.73410 XP_011536864.1.92137 XP_011758544.1.29376 XP_011791605.1.43180 XP_011842999.1.47321 gi|332000017|ref|NP_001193639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]