SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000449637 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000449637
Domain Number 1 Region: 1-152
Classification Level Classification E-value
Superfamily CBS-domain pair 4.42e-42
Family CBS-domain pair 0.0000000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000449637   Gene: ENSG00000181929   Transcript: ENST00000551121
Sequence length 161
Comment pep:putative chromosome:GRCh37:12:49397663:49412526:-1 gene:ENSG00000181929 transcript:ENST00000551121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFI
NILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHR
LPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSL
Download sequence
Identical sequences A0A2J8LQ31 A0A2J8SYQ9 F8VVA3
ENSP00000449637 ENSP00000449637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]