SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450112 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450112
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily CBS-domain pair 1.02e-22
Family CBS-domain pair 0.00000215
Further Details:      
 
Weak hits

Sequence:  ENSP00000450112
Domain Number - Region: 104-145
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000376
Family CBS-domain pair 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450112   Gene: ENSG00000181929   Transcript: ENST00000548950
Sequence length 145
Comment pep:putative chromosome:GRCh37:12:49397555:49412533:-1 gene:ENSG00000181929 transcript:ENST00000548950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSS
LIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANI
AMVRTTTPVYVALGIFVQHRVSALP
Download sequence
Identical sequences A0A2J8LQ49 A0A2J8SYR7 F8VPF5
ENSP00000450112 ENSP00000450112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]