SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450319 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450319
Domain Number 1 Region: 8-85
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000115
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number 2 Region: 81-104
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000458
Family B-box zinc-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450319   Gene: ENSG00000235960   Transcript: ENST00000548212
Sequence length 115
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_DBB:30121774:30130696:1 gene:ENSG00000235960 transcript:ENST00000548212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATPSLKVVHELPACTLCAGPLEDAVTIPCGHTFCRLCLPALSQMGAQSSGKILLCPLC
QEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVSECRTTDGFGCA
Download sequence
Identical sequences ENSP00000365878 ENSP00000446761 ENSP00000447500 ENSP00000448650 ENSP00000449617 ENSP00000449686 ENSP00000449949 ENSP00000450319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]