SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450557 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450557
Domain Number 1 Region: 67-172
Classification Level Classification E-value
Superfamily E set domains 0.000000000801
Family Filamin repeat (rod domain) 0.018
Further Details:      
 
Domain Number 2 Region: 449-501
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.0000196
Family Hect, E3 ligase catalytic domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450557   Gene: ENSG00000119682   Transcript: ENST00000555330
Sequence length 504
Comment pep:known chromosome:GRCh37:14:75127975:75152363:-1 gene:ENSG00000119682 transcript:ENST00000555330 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MFYVIGGITVSVVAFFFTIKFLFELAARVVSFLQNEDRERRGDRTIYDYVRGNYLDPRSC
KVSWDWKDPYEVGHSMAFRVHLFYKNGQPFPAHRPVGLRVHISHVELAVEIPVTQEVLQE
PNSNVVKVAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGMVVPSKTKIVCHFSTLVLT
CGQPHTLQIVPRDEYDNPTNNSMSLRDEHNYTLSIHELGPQEEESTGVSFEKSVTSNRQT
FQVFLRLTLHSRGCFHACISYQNQPINNGEFDIIVLSEDEKNIVERNVSTSGVSIYFEAY
LYNATNCSSTPWHLPPMHMTSSQRRPSTAVDEEDEDSPSECHTPEKVKKPKKVYCYVSPK
QFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDDGIQPPVELSCKERNI
LAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHALLESSLKATR
NFSISDWSKNFEVVFQDEEGASQP
Download sequence
Identical sequences A0A2I3MQM8 A0A2K5L5P9 A0A2K5U5A2 A0A2K5XKP4 A0A2K6BTQ2 G3V2B5
ENSP00000450557 ENSP00000450557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]