SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450644 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450644
Domain Number 1 Region: 421-596
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.12e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000139
Further Details:      
 
Domain Number 2 Region: 598-698
Classification Level Classification E-value
Superfamily E set domains 8.4e-26
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSP00000450644
Domain Number - Region: 100-126
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0575
Family Obg GTP-binding protein N-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450644   Gene: ENSG00000100968   Transcript: ENST00000554966
Sequence length 807
Comment pep:known chromosome:GRCh37:14:24836466:24846911:1 gene:ENSG00000100968 transcript:ENST00000554966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGRDLGAPAGSMGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLA
LGEPPPYGAAPIGIPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGG
GRVLECPSIRITSISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFF
SPSPGSSSLSSWSFFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTP
EDPWSLYGPSPGGRGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRR
GSLGEEGSEPPPPPPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEP
ASCNGKLPLGAEESVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLD
WPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMF
IGTADERNLRPHAFYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGIL
KLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQ
VEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLT
LTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASAT
PFGTDMDFSPPRPPYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPE
TRGTTVSEIIGRDLSGFPAPPGEEPPA
Download sequence
Identical sequences ENSP00000450644 ENSP00000450644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]