SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000450887 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450887
Domain Number 1 Region: 21-122
Classification Level Classification E-value
Superfamily E set domains 1.45e-31
Family ML domain 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450887   Gene: ENSG00000119655   Transcript: ENST00000555592
Sequence length 122
Comment pep:known chromosome:GRCh37:14:74951114:74960311:-1 gene:ENSG00000119655 transcript:ENST00000555592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SV
Download sequence
Identical sequences A0A2J8PJQ2 G3V2V8
ENSP00000450887 ENSP00000450887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]