SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000450999 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000450999
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily EF-hand 2.77e-42
Family EF-hand modules in multidomain proteins 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000450999   Gene: ENSG00000065357   Transcript: ENST00000553783
Sequence length 107
Comment pep:known chromosome:GRCh37:12:56325847:56331809:1 gene:ENSG00000065357 transcript:ENST00000553783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLE
Download sequence
Identical sequences A0A2J8Q1G1 G3V327
ENSP00000450999 ENSP00000450999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]