SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000451151 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451151
Domain Number 1 Region: 408-583
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.09e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000139
Further Details:      
 
Domain Number 2 Region: 585-685
Classification Level Classification E-value
Superfamily E set domains 8.22e-26
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSP00000451151
Domain Number - Region: 87-113
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0562
Family Obg GTP-binding protein N-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451151   Gene: ENSG00000100968   Transcript: ENST00000554050
Sequence length 794
Comment pep:known chromosome:GRCh37:14:24837226:24847262:1 gene:ENSG00000100968 transcript:ENST00000554050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITS
ISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEE
SVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRP
PYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTVSEIIGRD
LSGFPAPPGEEPPA
Download sequence
Identical sequences ENSP00000451151 gi|312176393|ref|NP_001185894.1| NP_001185894.1.87134 NP_001185894.1.92137 ENSP00000451151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]