SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000451206 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451206
Domain Number 1 Region: 21-148
Classification Level Classification E-value
Superfamily E set domains 5.13e-43
Family ML domain 0.000000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451206   Gene: ENSG00000119655   Transcript: ENST00000557510
Sequence length 174
Comment pep:putative chromosome:GRCh37:14:74946890:74960050:-1 gene:ENSG00000119655 transcript:ENST00000557510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQLSKGQSYSVNVT
FTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGINCPIQKDKTYSYLNKLPVKSEYP
SIKLVVEWQLQDDKNQSLFCWEIPVQIVSLSGGERAWVEGRKWRRNQTETKSVP
Download sequence
Identical sequences G3V3E8
XP_016876419.1.92137 ENSP00000451206 ENSP00000451206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]