SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000451375 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000451375
Domain Number 1 Region: 1-44
Classification Level Classification E-value
Superfamily E set domains 0.00000214
Family Filamin repeat (rod domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000451375   Gene: ENSG00000119682   Transcript: ENST00000553411
Sequence length 81
Comment pep:known chromosome:GRCh37:14:75142491:75150098:-1 gene:ENSG00000119682 transcript:ENST00000553411 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
VAFTVRKAGRYEITVKLGGLNVAYSPYYKIFQPGIGSHYVAQGGLELLDSSNLPALAFQS
VGITGVSQVTQPDYCSSYNKS
Download sequence
Identical sequences H0YJF1
ENSP00000451375 ENSP00000451375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]