SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000452143 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000452143
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily EF-hand 1.04e-17
Family Calmodulin-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000452143   Gene: ENSG00000140025   Transcript: ENST00000556005
Sequence length 118
Comment pep:known chromosome:GRCh37:14:90389670:90420867:-1 gene:ENSG00000140025 transcript:ENST00000556005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFKACDEDHKGYLSREDFKTAVVMLFGYKPSKIEVDSVMSSINPNTSGILLEGFLNIVR
KKKEAQRYRNEVRHIFTAFDTYYRGFLTLEDFKKAFRQVAPKLPERTVLEVFRGIFSA
Download sequence
Identical sequences A0A2J8PKT7
ENSP00000452143 ENSP00000452143 NP_001271197.1.87134 NP_001271197.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]