SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000453808 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000453808
Domain Number 1 Region: 412-748
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.97e-110
Family PDEase 0.00000168
Further Details:      
 
Domain Number 2 Region: 149-252
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000159
Family Heme-binding PAS domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSP00000453808
Domain Number - Region: 22-88
Classification Level Classification E-value
Superfamily CheY-like 0.000211
Family CheY-related 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000453808   Gene: ENSG00000073417   Transcript: ENST00000557957
Sequence length 757
Comment pep:putative chromosome:GRCh37:15:85523744:85682373:1 gene:ENSG00000073417 transcript:ENST00000557957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACFLDKHHDIIIIDH
RNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGFTRRYVENPNIMA
CYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQYANPAFETTMGYQS
GELIGKELGEVPINEKKADLLDTINSCIRIGKEWQGIYYAKKKNGDNIQQNVKIIPVIGQ
GGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTDNQTGKHKDRRKGSLDVKAVASRATEV
SSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLEILRTTELYSPQF
GAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPISLDDVPPRIARAM
ENEEYWDFDIFELEAATHNRPLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSS
NPYHNSTHSADVLHATAYFLSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAG
SELAILYNDTAVLESHHAALAFQLTTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTK
HFEHVNKFVNSINKPLATLEENGETDKNQEVINTMLRTPENRTLIKRMLIKCADVSNPCR
PLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPVFDRNTCSIPKSQISFIDYFITDMFDA
WDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRPPPE
Download sequence
Identical sequences NP_001230066.1.87134 NP_001230066.1.92137 ENSP00000453808 ENSP00000453808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]