SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455489 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455489
Domain Number 1 Region: 33-190
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.4e-39
Family Transglutaminase core 0.0000756
Further Details:      
 
Weak hits

Sequence:  ENSP00000455489
Domain Number - Region: 1-32
Classification Level Classification E-value
Superfamily E set domains 0.000119
Family Transglutaminase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455489   Gene: ENSG00000166947   Transcript: ENST00000569204
Sequence length 191
Comment pep:novel chromosome:GRCh37:15:43500488:43507386:-1 gene:ENSG00000166947 transcript:ENST00000569204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTAD
CIQAESWDFGQLHFLKEQRVLPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQ
AWVLAAVACTVLRCLGIPARVVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQ
TSTECWMTRPA
Download sequence
Identical sequences H3BPV8
ENSP00000455489 ENSP00000455489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]