SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000455964 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000455964
Domain Number 1 Region: 2-93
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.28e-23
Family cAMP-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000455964   Gene: ENSG00000070729   Transcript: ENST00000565942
Sequence length 126
Comment pep:putative chromosome:GRCh37:16:57918272:57935277:-1 gene:ENSG00000070729 transcript:ENST00000565942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGSVFGEISLLAVGGGNRRTA
NVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARPRARKTSRERKAPPPQTSTRTQR
RPPPTH
Download sequence
Identical sequences H3BQW3
ENSP00000455964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]