SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000456120 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000456120
Domain Number 1 Region: 407-582
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.21e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000957
Further Details:      
 
Domain Number 2 Region: 584-684
Classification Level Classification E-value
Superfamily E set domains 1.27e-29
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000456120   Gene: ENSG00000072736   Transcript: ENST00000562926
Sequence length 1053
Comment pep:putative chromosome:GRCh37:16:68119764:68260837:1 gene:ENSG00000072736 transcript:ENST00000562926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLDDRRPITLCVCVRARVCDLEPDDCASIYIFNVDPPPSTLTTPLCLPHHGLPSHSSVLS
PSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQIND
PEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSE
LNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWL
SPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASV
HGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSIDD
GLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPLDWPLPAHFGQCELKI
EVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYLRPHAF
YQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGET
DIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGG
HEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAA
VQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGC
SHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCRDESVSKEQHMIPSPIVHQPFQVTPT
PPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSGLVNLGCQPLSSIPFH
SSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQLQPITY
GPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHS
TQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDD
DQFISDLEHQPSGSAEKWPNHSVLSCPAPFWRI
Download sequence
Identical sequences H3BR83
ENSP00000456120 ENSP00000456120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]