SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457140 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457140
Domain Number 1 Region: 98-406
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-85
Family Transglutaminase core 0.000000738
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily E set domains 1.75e-24
Family Transglutaminase N-terminal domain 0.00084
Further Details:      
 
Domain Number 3 Region: 426-508
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-16
Family Transglutaminase, two C-terminal domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457140   Gene: ENSG00000166947   Transcript: ENST00000568508
Sequence length 543
Comment pep:novel chromosome:GRCh37:15:43489461:43508520:-1 gene:ENSG00000166947 transcript:ENST00000568508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVRAFLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVT
TPADAVIGHYSLLLQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIY
LGTADCIQAESWDFGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRV
LPTPQTQATQEGALLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPAR
VVTTFASAQGTGGRLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQ
ILHPSAPNGGGVLGSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELT
DSNTKYVGNNISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP
SLETASPLYLLLKAPSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLW
RKKLHLTLSANLDARESRAVSTPHSLSQPPELPRCPHGGLCDLHPGKGAHSQREELQIPF
SVA
Download sequence
Identical sequences H3BTE6
ENSP00000457140 ENSP00000457140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]