SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000457807 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000457807
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 1.17e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000852
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.3e-23
Family Voltage-gated potassium channels 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000457807   Gene: ENSG00000260458   Transcript: ENST00000567955
Sequence length 433
Comment pep:known chromosome:GRCh37:HG987_PATCH:21606053:21607836:1 gene:ENSG00000260458 transcript:ENST00000567955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAASRANPYSIVSLEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIAFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVAHGDLEPAEGHGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECLVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRGSEI
Download sequence
Identical sequences B7U540
NP_001181887.2.87134 NP_001181887.2.92137 ENSP00000457807 ENSP00000457807 ENSP00000456250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]