SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000458371 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458371
Domain Number 1 Region: 7-39
Classification Level Classification E-value
Superfamily E set domains 0.00000000000483
Family Arrestin/Vps26-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458371   Gene: ENSG00000141480   Transcript: ENST00000574502
Sequence length 64
Comment pep:known chromosome:GRCh37:17:4613891:4622708:1 gene:ENSG00000141480 transcript:ENST00000574502 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGEKPGTRVFKKSSPNCKLTVYLGKRDFVDHLDKVDPVDTPESSMLRHTAARPRGYRKGL
RRRL
Download sequence
Identical sequences I3L0V6
ENSP00000458371 ENSP00000458371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]