SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458512 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000458512
Domain Number - Region: 88-234
Classification Level Classification E-value
Superfamily ARM repeat 0.00012
Family Leucine-rich repeat variant 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458512   Gene: ENSG00000141556   Transcript: ENST00000577051
Sequence length 260
Comment pep:novel chromosome:GRCh37:17:80887014:80900535:1 gene:ENSG00000141556 transcript:ENST00000577051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQQASEKIDRFRAHAASVFLTLLHFDSPPIPHVPHRGELEKLFPRSDVASVNWSAPSQAF
PRITQLLGLPTYRYHVLLGLVVSLGGLTESTIRHSTQSLFEYMKGIQSDPQALGSFSGTL
LQIFEDNLLNESHPFAVKLLALCKKEIKNSKDIQKLLSGIAVFCEMVQFPGDVRRQALLQ
LCLLLCHRFPLIRKTTASQVYETLLTYSDVVGADVLDEVVTVLSDTAWDAELAVVREQRN
RLCDLLGVPRPQLVPQPGAC
Download sequence
Identical sequences I3L120
ENSP00000458512 ENSP00000458512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]