SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000458550 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000458550
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000425
Family Protein kinases, catalytic subunit 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000458550   Gene: ENSG00000141560   Transcript: ENST00000574356
Sequence length 145
Comment pep:known chromosome:GRCh37:17:80674625:80684792:1 gene:ENSG00000141560 transcript:ENST00000574356 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARRMFEGEMASLT
AILKTNTVKVPKPIKVLDAPGGGSVLVMEHMDMRHLSSHAAKLGAQLADLHLDNKKLGEM
RLKEAGTVEHNALSGSREFSGILIC
Download sequence
Identical sequences I3L139
ENSP00000458550 ENSP00000458550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]