SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000460879 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000460879
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily E set domains 1.96e-75
Family Arrestin/Vps26-like 0.000000213
Further Details:      
 
Weak hits

Sequence:  ENSP00000460879
Domain Number - Region: 167-196
Classification Level Classification E-value
Superfamily E set domains 0.000189
Family Arrestin/Vps26-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000460879   Gene: ENSG00000141480   Transcript: ENST00000576235
Sequence length 196
Comment pep:known chromosome:GRCh37:17:4614019:4623702:1 gene:ENSG00000141480 transcript:ENST00000576235 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
GGETRDQLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTCAFRYGREDLDV
LGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTIPQNLPCSVTLQ
PGPEDTGKACGVDFEIRAFCAKSLEEKSHKRNSVRLVIRKVQFAPEKPGPQPSAETTRHF
LMSDRSLHLEASLDKE
Download sequence
Identical sequences A0A2J8KQS5 A0A2J8SPN1 I3L412
ENSP00000460879 ENSP00000460879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]