SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000461956 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000461956
Domain Number 1 Region: 7-129
Classification Level Classification E-value
Superfamily E set domains 1.36e-42
Family RhoGDI-like 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000461956   Gene: ENSG00000141522   Transcript: ENST00000581876
Sequence length 129
Comment pep:novel chromosome:GRCh37:17:79826487:79829200:-1 gene:ENSG00000141522 transcript:ENST00000581876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSAVDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWN
LTIKKDWKD
Download sequence
Identical sequences A0A096NTJ4 A0A1D5QQ87 A0A2I2YHU7 A0A2I3TWB1 A0A2K5HE31 A0A2K5P407 A0A2K5WW76 A0A2K5XAI6 A0A2K6CZ14 A0A2K6LC22 A0A2K6PXB6 J3KRE2
ENSP00000461956 ENSP00000461956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]