SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000462178 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462178
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000196
Family Protein kinases, catalytic subunit 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462178   Gene: ENSG00000034152   Transcript: ENST00000527123
Sequence length 136
Comment pep:putative chromosome:GRCh37:17:21215454:21217198:1 gene:ENSG00000034152 transcript:ENST00000527123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLE
LMVSMGGRCLPCSSGLAGAGWGSGERAASCTQMGSSSGWPCVLSFRCSVICLLLHTWLPP
PSFLHARPWEGYTGSV
Download sequence
Identical sequences J3KRV4
ENSP00000462178 ENSP00000462178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]