SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000462209 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462209
Domain Number 1 Region: 7-145
Classification Level Classification E-value
Superfamily E set domains 1.4e-49
Family RhoGDI-like 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462209   Gene: ENSG00000141522   Transcript: ENST00000583868
Sequence length 249
Comment pep:putative chromosome:GRCh37:17:79826507:79829213:-1 gene:ENSG00000141522 transcript:ENST00000583868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMTTTRPTTCPGSGISPSRRTGRTEPSQRRAGQTDGR
TTDRRMCPPQPLPSPYQSADRPSVPLPPWSASLAWLNRVPPTPLLSPPPPTGPASSVSCL
VAASACAVG
Download sequence
Identical sequences H2RG12 J3KRY1
ENSP00000462209 ENSP00000462323 ENSP00000462209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]