SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000462323 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462323
Domain Number 1 Region: 7-91
Classification Level Classification E-value
Superfamily E set domains 6.37e-25
Family RhoGDI-like 0.00000759
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462323   Gene: ENSG00000141522   Transcript: ENST00000578351
Sequence length 92
Comment pep:known chromosome:GRCh37:17:79826925:79829202:-1 gene:ENSG00000141522 transcript:ENST00000578351 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTG
Download sequence
Identical sequences A0A2J8JG26 A0A2J8XZ00 J3KS60
ENSP00000462323 ENSP00000463530 ENSP00000462323 ENSP00000463530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]