SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000462960 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000462960
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily E set domains 1.56e-62
Family RhoGDI-like 0.0000000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000462960   Gene: ENSG00000141522   Transcript: ENST00000579121
Sequence length 193
Comment pep:putative chromosome:GRCh37:17:79826382:79828540:-1 gene:ENSG00000141522 transcript:ENST00000579121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGSISPSHPRPGFR
RERSSHSPGPVVA
Download sequence
Identical sequences J3KTF8
ENSP00000462960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]