SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463778 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463778
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 1.17e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000852
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.59e-24
Family Voltage-gated potassium channels 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463778   Gene: ENSG00000184185   Transcript: ENST00000583088
Sequence length 433
Comment pep:known chromosome:GRCh37:17:21279509:21323179:1 gene:ENSG00000184185 transcript:ENST00000583088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRESEI
Download sequence
Identical sequences Q14500
ENSP00000328150 ENSP00000456250 ENSP00000463778 ENSP00000476405 NP_066292.2.87134 NP_066292.2.92137 XP_005256682.1.92137 XP_011522133.1.92137 ENSP00000328150 ENSP00000457807 9606.ENSP00000328150 gi|23110982|ref|NP_066292.2| ENSP00000328150 ENSP00000463778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]