SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463939 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463939
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily E set domains 3.64e-62
Family RhoGDI-like 0.0000000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463939   Gene: ENSG00000141522   Transcript: ENST00000584461
Sequence length 235
Comment pep:putative chromosome:GRCh37:17:79826136:79829205:-1 gene:ENSG00000141522 transcript:ENST00000584461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGSISPSHPRPGFR
RERSSHSPGPVVAPGRVRLLLRGGAGVWDARPRGGRAVLQPRCSLASPLVAVGPV
Download sequence
Identical sequences J3QQX2
ENSP00000463939 ENSP00000463939 NP_001288169.1.87134 NP_001288169.1.92137 NP_001288170.1.87134 NP_001288170.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]