SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000463977 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000463977
Domain Number 1 Region: 93-190
Classification Level Classification E-value
Superfamily AMPKBI-like 2.49e-36
Family AMPKBI-like 0.00000434
Further Details:      
 
Domain Number 2 Region: 25-74
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000245
Family AMPK-beta glycogen binding domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000463977   Gene: ENSG00000266198   Transcript: ENST00000577930
Sequence length 190
Comment pep:known chromosome:GRCh37:HG1287_PATCH:147845905:147858882:-1 gene:ENSG00000266198 transcript:ENST00000577930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGRSTRSWWGVRTTPACSASLTPSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVV
TSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERF
KSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKK
YVTTLLYKPI
Download sequence
Identical sequences ENSP00000415469 ENSP00000463977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]