SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000465013 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465013
Domain Number 1 Region: 14-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 5.75e-19
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 
Domain Number 2 Region: 119-181
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000034
Family cAMP-binding domain 0.0000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465013   Gene: ENSG00000108946   Transcript: ENST00000588178
Sequence length 182
Comment pep:known chromosome:GRCh37:17:66511264:66521097:1 gene:ENSG00000108946 transcript:ENST00000588178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGSTAASEEARSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKE
EAKQIQNLQKAGTRTDSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPK
DYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFSVSFIAGETVIQQGDEGDNFYVIDQG
ET
Download sequence
Identical sequences K7EJ40
ENSP00000465013 ENSP00000465013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]