SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000465295 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465295
Domain Number 1 Region: 192-386
Classification Level Classification E-value
Superfamily E set domains 8.86e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000286
Further Details:      
 
Domain Number 2 Region: 90-207
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-21
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465295   Gene: ENSG00000153822   Transcript: ENST00000585558
Sequence length 453
Comment pep:putative chromosome:GRCh37:17:68100995:68131749:1 gene:ENSG00000153822 transcript:ENST00000585558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKMVLTENPNQEIATSLEFLLLQNSPGSLRAQQRMSYYGSSYHIINADAKYPGYPPEHI
IAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKWRHMFVIFSLSYILSW
LIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTGAFLFSLETQTTIGYGYRCVTEECSV
AVLMVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGD
FRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYA
LDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNC
LQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVRESCTSDTKARRRSFSAVAIVSSCEN
PEETTTSATHEYRETPYQKALLTLNRISVESQM
Download sequence
Identical sequences K7EJR9
NP_001278551.1.87134 NP_001278551.1.92137 NP_001278552.1.87134 NP_001278552.1.92137 NP_061128.2.87134 NP_061128.2.92137 NP_733937.2.87134 NP_733937.2.92137 NP_733938.2.87134 NP_733938.2.92137 XP_005257394.1.92137 XP_006721948.1.92137 XP_006721949.1.92137 XP_006721950.1.92137 XP_016880098.1.92137 XP_016880099.1.92137 XP_016880100.1.92137 XP_016880101.1.92137 ENSP00000465295 ENSP00000465295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]