SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000465323 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465323
Domain Number 1 Region: 1-111
Classification Level Classification E-value
Superfamily E set domains 1.25e-33
Family RhoGDI-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465323   Gene: ENSG00000109103   Transcript: ENST00000470125
Sequence length 125
Comment pep:putative chromosome:GRCh37:17:26873729:26876417:-1 gene:ENSG00000109103 transcript:ENST00000470125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKP
VNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELSARAGSSGSGEV
GASRD
Download sequence
Identical sequences K7EJU3
ENSP00000465323 ENSP00000465323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]