SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000465877 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465877
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily E set domains 1.31e-40
Family Arrestin/Vps26-like 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465877   Gene: ENSG00000141480   Transcript: ENST00000571428
Sequence length 113
Comment pep:putative chromosome:GRCh37:17:4613992:4622713:1 gene:ENSG00000141480 transcript:ENST00000571428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKC
PVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASST
Download sequence
Identical sequences A0A2J8SPM2 K7EL17
ENSP00000465877 ENSP00000465877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]