SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000465967 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000465967
Domain Number 1 Region: 157-351
Classification Level Classification E-value
Superfamily E set domains 7.46e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000286
Further Details:      
 
Domain Number 2 Region: 55-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-21
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000465967   Gene: ENSG00000153822   Transcript: ENST00000589377
Sequence length 418
Comment pep:known chromosome:GRCh37:17:68071462:68131749:1 gene:ENSG00000153822 transcript:ENST00000589377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR
ESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM
Download sequence
Identical sequences Q9NPI9
NP_001257351.1.87134 NP_001257351.1.92137 NP_001278553.1.87134 NP_001278553.1.92137 NP_001278554.1.87134 NP_001278554.1.92137 XP_011523083.1.92137 XP_016880102.1.92137 9606.ENSP00000283936 gi|25777628|ref|NP_733937.1| gi|25777630|ref|NP_733938.1| gi|8923823|ref|NP_061128.1| ENSP00000283936 ENSP00000376438 ENSP00000376439 ENSP00000465967 ENSP00000283936 ENSP00000376438 ENSP00000376439 ENSP00000465967 ENSP00000479817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]