SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466314 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466314
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-21
Family cAMP-binding domain 0.0000157
Further Details:      
 
Domain Number 2 Region: 3-44
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000011
Family cAMP-binding domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466314   Gene: ENSG00000108946   Transcript: ENST00000592800
Sequence length 153
Comment pep:putative chromosome:GRCh37:17:66521936:66526795:1 gene:ENSG00000108946 transcript:ENST00000592800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSIL
ESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVG
RLGPSDYFGMYEFPHNKYMVSLSHLSVRYCSLP
Download sequence
Identical sequences K7EM13
ENSP00000466314 ENSP00000466314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]