SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466344 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466344
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily E set domains 2.66e-62
Family Arrestin/Vps26-like 0.0000000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466344   Gene: ENSG00000141480   Transcript: ENST00000574954
Sequence length 217
Comment pep:putative chromosome:GRCh37:17:4613925:4624391:1 gene:ENSG00000141480 transcript:ENST00000574954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKC
PVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGAN
KEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTN
LIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC
Download sequence
Identical sequences A0A2J8SPK3 Q68DZ5
ENSP00000460607 ENSP00000465296 ENSP00000466344 XP_006721583.1.92137 ENSP00000460607 ENSP00000465296 ENSP00000466344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]