SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000466831 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000466831
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily E set domains 2.52e-46
Family RhoGDI-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000466831   Gene: ENSG00000109103   Transcript: ENST00000484980
Sequence length 145
Comment pep:putative chromosome:GRCh37:17:26873726:26878820:-1 gene:ENSG00000109103 transcript:ENST00000484980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKP
VNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQ
SDSFYFVDDRLVMHNKADYSYSGTP
Download sequence
Identical sequences A0A2J8LI24 A0A2J8TMF0 G3R2L0 K7EN86
NP_001300917.1.92730 XP_003812723.1.60992 XP_016819205.1.69978 XP_016823998.1.28591 XP_016880778.1.92137 XP_018883504.1.27298 ENSP00000466831 ENSP00000466831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]