SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000469340 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469340
Domain Number 1 Region: 362-580
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.13e-59
Family Ankyrin repeat 0.0000188
Further Details:      
 
Domain Number 2 Region: 68-200
Classification Level Classification E-value
Superfamily E set domains 2.57e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000113
Further Details:      
 
Domain Number 3 Region: 10-72
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.37e-18
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000363
Further Details:      
 
Domain Number 4 Region: 628-709
Classification Level Classification E-value
Superfamily DEATH domain 5.42e-16
Family DEATH domain, DD 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSP00000469340
Domain Number - Region: 694-742
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00798
Family DNA polymerase beta, N-terminal domain-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469340   Gene: ENSG00000109320   Transcript: ENST00000600343
Sequence length 788
Comment pep:putative chromosome:GRCh37:4:103498871:103538255:1 gene:ENSG00000109320 transcript:ENST00000600343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLCCMALDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
Download sequence
Identical sequences A0A2J8MAY9
ENSP00000469340 ENSP00000469340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]