SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000469720 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000469720
Domain Number 1 Region: 25-171
Classification Level Classification E-value
Superfamily EF-hand 8.79e-70
Family Calmodulin-like 0.00000834
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000469720   Gene: ENSG00000268512   Transcript: ENST00000601896
Sequence length 172
Comment pep:known chromosome:GRCh37:HG1497_PATCH:151995445:151999249:-1 gene:ENSG00000268512 transcript:ENST00000601896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRAL
GFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGK
ISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Download sequence
Identical sequences A0A2I3GMP3 A0A2I3SUG9 G3R6X2 H2PX40 P41208
ENSGGOP00000011095 ENSPPYP00000023317 2ggm_A 2ggm_B ENSP00000359300 NP_004335.1.87134 NP_004335.1.92137 XP_001139392.3.37143 XP_002832316.2.23681 XP_003271935.2.23891 XP_003805018.1.60992 XP_004065102.1.27298 XP_016799961.1.37143 ENSNLEP00000016825 9598.ENSPTRP00000038570 9600.ENSPPYP00000023317 9606.ENSP00000359300 ENSP00000359300 2ggmA ENSNLEP00000016825 ENSP00000359300 ENSP00000469720 gi|4757902|ref|NP_004335.1| ENSGGOP00000011095 ENSPTRP00000038570 ENSPTRP00000038570 ENSPPYP00000023317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]