SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000470026 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000470026
Domain Number 1 Region: 113-160,200-464,498-643
Classification Level Classification E-value
Superfamily Clc chloride channel 1.7e-127
Family Clc chloride channel 0.00011
Further Details:      
 
Domain Number 2 Region: 651-811
Classification Level Classification E-value
Superfamily CBS-domain pair 2.91e-32
Family CBS-domain pair 0.0000000523
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000470026   Gene: ENSG00000269240   Transcript: ENST00000594930
Sequence length 816
Comment pep:known chromosome:GRCh37:HG1436_HG1432_PATCH:49732014:49908634:1 gene:ENSG00000269240 transcript:ENST00000594930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMWQGAMDNRGFQQGSFSSFQNSSSDEDLMDIPATAMDFSMRDDVPPLDREVGEDKSYN
GGGIGSSNRIMDFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHS
VSDAFSGWLLMLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEHCCWNSEHVTF
EERDKCPEWNSWSQLIISTDEGAFAYIVNYFMYVLWALLFAFLAVSLVKVFAPYACGSGI
PEIKTILSGFIIRGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNILCHCFN
KYRKNEAKRREVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAAF
TLRSINPFGNSRLVLFYVEFHTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTT
QLGKYPVIEVLVVTAITAILAFPNEYTRMSTSELISELFNDCGLLDSSKLCDYENRFNTS
KGGELPDRPAGVGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLG
VGMEQLAYYHQEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTG
GLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDVMKPRR
NDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKK
QDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQ
CLVTHNGRLLGIITKKDVLKHIAQMANQDPDSILFN
Download sequence
Identical sequences K7B9J0
ENSP00000365256 ENSP00000365259 ENSP00000470026 ENSP00000470125 9606.ENSP00000365256 NP_001121370.1.87134 NP_001121370.1.92137 NP_001121371.1.87134 NP_001121371.1.92137 XP_003806005.1.60992 XP_003806006.1.60992 XP_016798935.1.37143 XP_016798936.1.37143 ENSP00000365256 ENSP00000365259 ENSP00000365256 gi|189217921|ref|NP_001121370.1| gi|189217923|ref|NP_001121371.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]